- Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2130 (AF_2130)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1025456
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 11,630 Da
- E Coli or Yeast
- 36161
- Uncharacterized protein AF_2130 (AF_2130)
Sequence
MDATTNFFISYFLPLISFLGLLNLLYTLYSRSRMDRLRFISSSVVSIFTILFGTMPYARYNRLLGESFCNLMVFVLPVSFFLVSLLLWLLRNKYVSELK